SCOP 1.71: Domain d1j9ct1: 1j9c T:1-106

Lineage for d1j9ct1 (1j9c T:1-106)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (28 proteins)
   Pfam 00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (10 PDB entries)

8. Domain d1j9ct1: 1j9c T:1-106 [103844]
   Other proteins in same PDB: d1j9ch_, d1j9cl1, d1j9cl2

Details for d1j9ct1

PDB Entry: 1j9c, 2.9 Å

PDB Description: crystal structure of tissue factor-factor viia complex

SCOP Domain Sequences for d1j9ct1:

Sequence; same for both SEQRES and ATOM records:

>d1j9ct1 b.1.2.1 (T:1-106) Extracellular region of human tissue factor {Human (Homo sapiens)}
sgttntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdlt
deivkdvkqtylarvfsypagnvestgsageplyenspeftpylet

Timeline for d1j9ct1:

• d1j9ct1 first appeared in SCOP 1.69
  
• d1j9ct1 appears in SCOP 1.73
  
• d1j9ct1 appears in the current release, SCOPe 2.08