SCOPe 2.04: Domain d1j9cl2: 1j9c L:87-142

Lineage for d1j9cl2 (1j9c L:87-142)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Coagulation factor VIIa [57201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57202] (45 PDB entries)
   Uniprot P08709 108-202 ! Uniprot P08709 107-202

8. Domain d1j9cl2: 1j9c L:87-142 [103843]
   Other proteins in same PDB: d1j9ch_, d1j9ct1, d1j9ct2
   complexed with 0z6, ca, ful, glc, nag

Details for d1j9cl2

PDB Entry: 1j9c, 2.9 Å

PDB Description: crystal structure of tissue factor-factor viia complex

PDB Compounds: (L:) factor VIIa light chain

SCOPe Domain Sequences for d1j9cl2:

Sequence; same for both SEQRES and ATOM records:

>d1j9cl2 g.3.11.1 (L:87-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile

Timeline for d1j9cl2:

• d1j9cl2 first appeared in SCOP 1.69
  
• d1j9cl2 appears in SCOPe 2.03
  
• d1j9cl2 appears in SCOPe 2.05
  
• d1j9cl2 appears in the current release, SCOPe 2.08