| Class g: Small proteins [56992] (85 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (7 families) ![]() |
| Family g.3.11.1: EGF-type module [57197] (22 proteins) |
| Protein Coagulation factor VIIa [57201] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57202] (19 PDB entries) |
| Domain d1j9cl2: 1j9c L:87-142 [103843] Other proteins in same PDB: d1j9ch_, d1j9ct1, d1j9ct2 complexed with ca, fuc, glc, nag |
PDB Entry: 1j9c (more details), 2.9 Å
SCOP Domain Sequences for d1j9cl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j9cl2 g.3.11.1 (L:87-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile
Timeline for d1j9cl2: