Lineage for d1j9cl2 (1j9c L:87-142)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 521093Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 521739Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 521740Family g.3.11.1: EGF-type module [57197] (21 proteins)
  6. 521749Protein Coagulation factor VIIa [57201] (1 species)
  7. 521750Species Human (Homo sapiens) [TaxId:9606] [57202] (15 PDB entries)
  8. 521768Domain d1j9cl2: 1j9c L:87-142 [103843]
    Other proteins in same PDB: d1j9ch_, d1j9ct1, d1j9ct2

Details for d1j9cl2

PDB Entry: 1j9c (more details), 2.9 Å

PDB Description: crystal structure of tissue factor-factor viia complex

SCOP Domain Sequences for d1j9cl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j9cl2 g.3.11.1 (L:87-142) Coagulation factor VIIa {Human (Homo sapiens)}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile

SCOP Domain Coordinates for d1j9cl2:

Click to download the PDB-style file with coordinates for d1j9cl2.
(The format of our PDB-style files is described here.)

Timeline for d1j9cl2: