SCOPe 2.01: Domain d1j3fa_: 1j3f A:

Lineage for d1j3fa_ (1j3f A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (225 PDB entries)
   Uniprot P02185

8. Domain d1j3fa_: 1j3f A: [103835]
   complexed with cr, czm, po4

Details for d1j3fa_

PDB Entry: 1j3f, 1.45 Å

PDB Description: crystal structure of an artificial metalloprotein:cr(iii)(3,3'-me2- salophen)/apo-a71g myoglobin

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1j3fa_:

Sequence, based on SEQRES records:

>d1j3fa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltglgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgdfgadaqgamnkalelfrkdiaakykelgyqg

Sequence, based on observed residues (ATOM records):

>d1j3fa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltglgailkkkghheaelkplaqshatkipikylefiseaiihvlhsrhpg
dfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d1j3fa_:

• d1j3fa_ first appeared in SCOP 1.69
  
• d1j3fa_ appears in SCOP 1.75
  
• d1j3fa_ appears in SCOPe 2.02
  
• d1j3fa_ appears in the current release, SCOPe 2.08