SCOP 1.73: Domain d1hl1a2: 1hl1 A:183-356

Lineage for d1hl1a2 (1hl1 A:183-356)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (7 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)

6. Protein Spore coat protein A, CotA [89219] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [89220] (12 PDB entries)

8. Domain d1hl1a2: 1hl1 A:183-356 [103821]

Details for d1hl1a2

PDB Entry: 1hl1, 2.69 Å

PDB Description: crystal structure of bacillus subtilis cota after20h soaking with abts

PDB Compounds: (A:) spore coat protein a

SCOP Domain Sequences for d1hl1a2:

Sequence; same for both SEQRES and ATOM records:

>d1hl1a2 b.6.1.3 (A:183-356) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]}
klpsdeydvpllitdrtinedgslfypsapenpspslpnpsivpafcgetilvngkvwpy
leveprkyrfrvinasntrtynlsldnggdfiqigsdggllprsvklnsfslapaerydi
iidftayegesiilansagcggdvnpetdanimqfrvtkplaqkdesrkpkyla

Timeline for d1hl1a2:

• d1hl1a2 first appeared in SCOP 1.69
  
• d1hl1a2 appears in SCOP 1.71
  
• d1hl1a2 last appears in SCOP 1.75