Lineage for d1h9hi_ (1h9h I:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1459078Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1459247Superfamily g.3.2: Plant inhibitors of proteinases and amylases [57027] (1 family) (S)
  5. 1459248Family g.3.2.1: Plant inhibitors of proteinases and amylases [57028] (4 proteins)
  6. 1459259Protein Trypsin inhibitor [57029] (5 species)
  7. 1459263Species Jumping cucumber (Ecballium elaterium) [TaxId:3679] [57033] (7 PDB entries)
    Uniprot P12071
  8. 1459266Domain d1h9hi_: 1h9h I: [103811]
    Other proteins in same PDB: d1h9he_
    complexed with ca

Details for d1h9hi_

PDB Entry: 1h9h (more details), 1.5 Å

PDB Description: complex of eeti-ii with porcine trypsin
PDB Compounds: (I:) trypsin inhibitor II

SCOPe Domain Sequences for d1h9hi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h9hi_ g.3.2.1 (I:) Trypsin inhibitor {Jumping cucumber (Ecballium elaterium) [TaxId: 3679]}
gcprilirckqdsdclagcvcgpngfcgsp

SCOPe Domain Coordinates for d1h9hi_:

Click to download the PDB-style file with coordinates for d1h9hi_.
(The format of our PDB-style files is described here.)

Timeline for d1h9hi_: