Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.119: DAK1/DegV-like [82548] (1 superfamily) 2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest] |
Superfamily c.119.1: DAK1/DegV-like [82549] (2 families) domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different |
Family c.119.1.2: DAK1 [109613] (2 proteins) Pfam 02733 |
Protein Dihydroxyacetone kinase [109616] (1 species) contains additional alpha-helical, ATP-binding domain |
Species Citrobacter freundii [TaxId:546] [109617] (2 PDB entries) |
Domain d1un8b4: 1un8 B:1-335 [103807] Other proteins in same PDB: d1un8a1, d1un8b1 complexed with myy |
PDB Entry: 1un8 (more details), 2.5 Å
SCOP Domain Sequences for d1un8b4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1un8b4 c.119.1.2 (B:1-335) Dihydroxyacetone kinase {Citrobacter freundii} msqfffnqrthlvsdvidgaiiaspwnnlarlesdpairivvrrdlnknnvavisgggsg hepahvgfigkgmltaavcgdvfaspsvdavltaiqavtgeagcllivknytgdrlnfgl aaekarrlgynvemlivgddislpdnkhprgiagtilvhkiagyfaergynlatvlreaq yaasntfslgvalsschlpqetdaaprhhpghaelgmgihgepgasvidtqnsaqvvnlm vdkllaalpetgrlavminnlggvsvaemaiitrelassplhsridwligpaslvtaldm kgfsltaivleesiekalltevetsnwptpvppre
Timeline for d1un8b4: