Lineage for d1oi2b_ (1oi2 B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 496281Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
    2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]
  4. 496282Superfamily c.119.1: DAK1/DegV-like [82549] (2 families) (S)
    domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different
  5. 496291Family c.119.1.2: DAK1 (Pfam 02733) [109613] (2 proteins)
  6. 496298Protein Dihydroxyacetone kinase subunit K, DhaK [109614] (1 species)
  7. 496299Species Escherichia coli [TaxId:562] [109615] (4 PDB entries)
    gene product YcgT
  8. 496301Domain d1oi2b_: 1oi2 B: [103803]

Details for d1oi2b_

PDB Entry: 1oi2 (more details), 1.75 Å

PDB Description: x-ray structure of the dihydroxyacetone kinase from escherichia coli

SCOP Domain Sequences for d1oi2b_:

Sequence, based on SEQRES records: (download)

>d1oi2b_ c.119.1.2 (B:) Dihydroxyacetone kinase subunit K, DhaK {Escherichia coli}
dvldeqlaglakahpsltlhqdpvyvtradapvagkvallsgggsghepmhcgyigqgml
sgacpgeiftsptpdkifecamqvdggegvlliiknytgdilnfetatellhdsgvkvtt
vvidddvavkdslytagrrgvantvlieklvgaaaergdsldacaelgrklnnqghsigi
algactvpaagkpsftladnemefgvgihgepgidrrpfssldqtvdemfdtllvngsyh
rtlrfwdyqqgswqeeqqtkqplqsgdrvialvnnlgatplselygvynrlttrcqqagl
tiernligayctsldmtgfsitllkvddetlalwdapvhtpalnwgk

Sequence, based on observed residues (ATOM records): (download)

>d1oi2b_ c.119.1.2 (B:) Dihydroxyacetone kinase subunit K, DhaK {Escherichia coli}
dvldeqlaglakahpsltlhqdpvyvtradapvagkvallsgggsghepmhcgyigqgml
sgacpgeiftsptpdkifecamqvdggegvlliiknytgdilnfetatellhdsgvkvtt
vvidddvavkdslytagrrgvantvlieklvgaaaergdsldacaelgrklnnqghsigi
algacladnemefgvgihgepgidrrpfssldqtvdemfdtllvngsyhrtlrfwdyqqg
swqeeqqtkqplqsgdrvialvnnlgatplselygvynrlttrcqqagltiernligayc
tsldmtgfsitllkvddetlalwdapvhtpalnwgk

SCOP Domain Coordinates for d1oi2b_:

Click to download the PDB-style file with coordinates for d1oi2b_.
(The format of our PDB-style files is described here.)

Timeline for d1oi2b_: