SCOP 1.73: Domain d2ck0l1: 2ck0 L:1-117

Lineage for d2ck0l1 (2ck0 L:1-117)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (35 PDB entries)

8. Domain d2ck0l1: 2ck0 L:1-117 [100855]
   Other proteins in same PDB: d2ck0h1, d2ck0h2, d2ck0l2
   part of anti-anti-idiotypic Fab against human angiotensin II, complex with a synthetic cyclic peptide

Details for d2ck0l1

PDB Entry: 2ck0, 2.2 Å

PDB Description: anti-anti-idiotypic antibody against human angiotensin ii, complex with a synthetic cyclic peptide

PDB Compounds: (L:) protein (immunoglobulin; light chain)

SCOP Domain Sequences for d2ck0l1:

Sequence; same for both SEQRES and ATOM records:

>d2ck0l1 b.1.1.1 (L:1-117) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
diqltqspsslavsagekvtmnckssqnllhsitrknylawyrqkpgqspklliywastr
gsgvpdrftgsgsgtdftltissvqaedlavyyckqsynlytfgggtkleikradaaptv
sif

Timeline for d2ck0l1:

• d2ck0l1 first appeared in SCOP 1.67
  
• d2ck0l1 appears in SCOP 1.71
  
• d2ck0l1 appears in SCOP 1.75
  
• d2ck0l1 appears in the current release, SCOPe 2.08