Lineage for d2ck0h2 (2ck0 H:107-216)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453267Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 453396Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries)
  8. 453518Domain d2ck0h2: 2ck0 H:107-216 [100854]
    Other proteins in same PDB: d2ck0h1, d2ck0l1, d2ck0l2
    part of anti-anti-idiotypic Fab against human angiotensin II, complex with a synthetic cyclic peptide

Details for d2ck0h2

PDB Entry: 2ck0 (more details), 2.2 Å

PDB Description: anti-anti-idiotypic antibody against human angiotensin ii, complex with a synthetic cyclic peptide

SCOP Domain Sequences for d2ck0h2:

Sequence, based on SEQRES records: (download)

>d2ck0h2 b.1.1.2 (H:107-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
wgqgttltvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssg
vhtfpavlqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivn

Sequence, based on observed residues (ATOM records): (download)

>d2ck0h2 b.1.1.2 (H:107-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
wgqgttltvssakttppsvyplapmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
qsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivn

SCOP Domain Coordinates for d2ck0h2:

Click to download the PDB-style file with coordinates for d2ck0h2.
(The format of our PDB-style files is described here.)

Timeline for d2ck0h2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ck0h1