![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins) |
![]() | Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
![]() | Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (43 PDB entries) |
![]() | Domain d2ck0h1: 2ck0 H:1-106 [100853] Other proteins in same PDB: d2ck0h2, d2ck0l1, d2ck0l2 part of anti-anti-idiotypic Fab against human angiotensin II, complex with a synthetic cyclic peptide |
PDB Entry: 2ck0 (more details), 2.2 Å
SCOP Domain Sequences for d2ck0h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ck0h1 b.1.1.1 (H:1-106) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} qvqlqesggglvqprgslklscaasgftfntdamnwvrqapgkglewvarirskgfnfat yyadsvrdrftisrddsqsmlylqmnnlktedtgiyycvrgrdgeamdy
Timeline for d2ck0h1: