Lineage for d1vjxa_ (1vjx A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766020Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 766572Protein Hypothetical protein TM1526 [101132] (1 species)
  7. 766573Species Thermotoga maritima [TaxId:2336] [101133] (1 PDB entry)
  8. 766574Domain d1vjxa_: 1vjx A: [100837]
    structural genomics

Details for d1vjxa_

PDB Entry: 1vjx (more details), 2.3 Å

PDB Description: Crystal structure of a putative ferritin-like diiron-carboxylate protein (tm1526) from thermotoga maritima at 2.30 A resolution
PDB Compounds: (A:) putative ferritin-like diiron-carboxylate protein TM1526

SCOP Domain Sequences for d1vjxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vjxa_ a.25.1.1 (A:) Hypothetical protein TM1526 {Thermotoga maritima [TaxId: 2336]}
hhhhmkvsdiltvairleeegerfyrelsehfngeikktfleladqerihaeifrkmsdq
enwdevdsylagyafyevfpdtseilrrkdltlkevldiaisvekdsiilyyelkdglvn
sdaqktvkkiidqekehlrkllemkrest

SCOP Domain Coordinates for d1vjxa_:

Click to download the PDB-style file with coordinates for d1vjxa_.
(The format of our PDB-style files is described here.)

Timeline for d1vjxa_: