Lineage for d1vjta2 (1vjt A:192-469)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 513617Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 513618Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 513795Family d.162.1.2: AglA-like glucosidase [90050] (4 proteins)
    family 4 glycosyl hydrolase
  6. 513815Protein Putative alpha-glucosidase TM0752 [103327] (1 species)
  7. 513816Species Thermotoga maritima [TaxId:243274] [103328] (1 PDB entry)
  8. 513817Domain d1vjta2: 1vjt A:192-469 [100834]
    Other proteins in same PDB: d1vjta1
    structural genomics

Details for d1vjta2

PDB Entry: 1vjt (more details), 2.5 Å

PDB Description: Crystal structure of Alpha-glucosidase (TM0752) from Thermotoga maritima at 2.50 A resolution

SCOP Domain Sequences for d1vjta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vjta2 d.162.1.2 (A:192-469) Putative alpha-glucosidase TM0752 {Thermotoga maritima}
ekldldpeevdwqvagvnhgiwlnrfryrgedayplldewiekklpewepknpwdtqmsp
aamdmykfygmlpigdtvrngswkyhynletkkkwfgkfggidneverpkfheqlrrare
rliklaeevqqnpgmklteehpeifpkgklsgeqhipfinaiannkrvrlflnvenqgtl
kdfpddvvmelpvwvdccgihrekvepdlthrikifylwprilrmewnleayisrdrkvl
eeilirdprtksyeqivqvldeifnlpfneelrryyke

SCOP Domain Coordinates for d1vjta2:

Click to download the PDB-style file with coordinates for d1vjta2.
(The format of our PDB-style files is described here.)

Timeline for d1vjta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vjta1