Lineage for d1vjpa1 (1vjp A:0-209,A:317-381)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 820760Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 821220Protein Hypothetical protein TM1419 [102161] (1 species)
    myo-inositol 1-phosphate synthase-related protein
  7. 821221Species Thermotoga maritima [TaxId:2336] [102162] (1 PDB entry)
  8. 821222Domain d1vjpa1: 1vjp A:0-209,A:317-381 [100828]
    Other proteins in same PDB: d1vjpa2
    structural genomics
    complexed with cl, mo2, nad

Details for d1vjpa1

PDB Entry: 1vjp (more details), 1.7 Å

PDB Description: Crystal structure of MYO-inositol-1-phosphate synthase-related protein (TM1419) from Thermotoga maritima at 1.70 A resolution
PDB Compounds: (A:) Myo-inositol-1-phosphate synthase-related protein

SCOP Domain Sequences for d1vjpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vjpa1 c.2.1.3 (A:0-209,A:317-381) Hypothetical protein TM1419 {Thermotoga maritima [TaxId: 2336]}
hmvkvlilgqgyvastfvagleklrkgeiepygvplarelpigfedikivgsydvdraki
gkklsevvkqywndvdsltsdpeirkgvhlgsvrnlpieaegledsmtlkeavdtlvkew
teldpdvivntctteafvpfgnkedllkaienndkerltatqvyayaaalyankrggaaf
vnviptfiandpafvelakennlvvfgddgXspalggllvdlvrlgkialdrkefgtvyp
vnafymknpgpaeeknipriiayekmriwaglkpkw

SCOP Domain Coordinates for d1vjpa1:

Click to download the PDB-style file with coordinates for d1vjpa1.
(The format of our PDB-style files is described here.)

Timeline for d1vjpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vjpa2