SCOP 1.75: Domain d1vjjb1: 1vjj B:1-140

Lineage for d1vjjb1 (1vjj B:1-140)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (23 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)

6. Protein Transglutaminase N-terminal domain [49235] (4 species)
   elaborated with many loop insertions in the common fold

7. Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74845] (8 PDB entries)

8. Domain d1vjjb1: 1vjj B:1-140 [100818]
   Other proteins in same PDB: d1vjja2, d1vjja3, d1vjja4, d1vjjb2, d1vjjb3, d1vjjb4
   complexed with ca, cl, gdp, mg; mutant

Details for d1vjjb1

PDB Entry: 1vjj, 1.9 Å

PDB Description: Structural Basis for the Coordinated Regulation of Transglutaminase 3 by Guanine Nucleotides and Calcium/Magnesium

PDB Compounds: (B:) Protein-glutamine glutamyltransferase E

SCOP Domain Sequences for d1vjjb1:

Sequence; same for both SEQRES and ATOM records:

>d1vjjb1 b.1.18.9 (B:1-140) Transglutaminase N-terminal domain {Human (Homo sapiens), TGase E3 [TaxId: 9606]}
aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
gissvklgtfillfnpwlnv

Timeline for d1vjjb1:

• d1vjjb1 first appeared in SCOP 1.67
  
• d1vjjb1 appears in SCOP 1.73
  
• d1vjjb1 does not appear in SCOPe 2.01