Lineage for d1vjjb1 (1vjj B:1-140)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 367734Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 368074Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)
  6. 368075Protein Transglutaminase N-terminal domain [49235] (4 species)
    elaborated with many loop insertions in the common fold
  7. 368093Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74845] (8 PDB entries)
  8. 368095Domain d1vjjb1: 1vjj B:1-140 [100818]
    Other proteins in same PDB: d1vjja2, d1vjja3, d1vjja4, d1vjjb2, d1vjjb3, d1vjjb4
    complexed with ca, cl, gdp, mg; mutant

Details for d1vjjb1

PDB Entry: 1vjj (more details), 1.9 Å

PDB Description: Structural Basis for the Coordinated Regulation of Transglutaminase 3 by Guanine Nucleotides and Calcium/Magnesium

SCOP Domain Sequences for d1vjjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vjjb1 b.1.18.9 (B:1-140) Transglutaminase N-terminal domain {Human (Homo sapiens), TGase E3}
aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
gissvklgtfillfnpwlnv

SCOP Domain Coordinates for d1vjjb1:

Click to download the PDB-style file with coordinates for d1vjjb1.
(The format of our PDB-style files is described here.)

Timeline for d1vjjb1: