Lineage for d1vjja1 (1vjj A:1-140)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 789453Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)
  6. 789454Protein Transglutaminase N-terminal domain [49235] (4 species)
    elaborated with many loop insertions in the common fold
  7. 789472Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74845] (8 PDB entries)
  8. 789473Domain d1vjja1: 1vjj A:1-140 [100814]
    Other proteins in same PDB: d1vjja2, d1vjja3, d1vjja4, d1vjjb2, d1vjjb3, d1vjjb4

Details for d1vjja1

PDB Entry: 1vjj (more details), 1.9 Å

PDB Description: Structural Basis for the Coordinated Regulation of Transglutaminase 3 by Guanine Nucleotides and Calcium/Magnesium
PDB Compounds: (A:) Protein-glutamine glutamyltransferase E

SCOP Domain Sequences for d1vjja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vjja1 b.1.18.9 (A:1-140) Transglutaminase N-terminal domain {Human (Homo sapiens), TGase E3 [TaxId: 9606]}
aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
gissvklgtfillfnpwlnv

SCOP Domain Coordinates for d1vjja1:

Click to download the PDB-style file with coordinates for d1vjja1.
(The format of our PDB-style files is described here.)

Timeline for d1vjja1: