SCOPe 2.07: Domain d1vj7b1: 1vj7 B:5-196

Lineage for d1vj7b1 (1vj7 B:5-196)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.1: HD domain [101340] (14 proteins)
   Pfam PF01966; metal dependent phosphohydrolases

6. Protein Stringent response-like protein RelA N-terminal domain [101341] (1 species)

7. Species Streptococcus equisimilis [TaxId:119602] [101342] (1 PDB entry)

8. Domain d1vj7b1: 1vj7 B:5-196 [100803]
   Other proteins in same PDB: d1vj7a2, d1vj7b2
   complexed with gdp, gpx, mn

Details for d1vj7b1

PDB Entry: 1vj7, 2.1 Å

PDB Description: Crystal structure of the bifunctional catalytic fragment of RelSeq, the RelA/SpoT homolog from Streptococcus equisimilis.

PDB Compounds: (B:) Bifunctional RELA/SPOT

SCOPe Domain Sequences for d1vj7b1:

Sequence, based on SEQRES records:

>d1vj7b1 a.211.1.1 (B:5-196) Stringent response-like protein RelA N-terminal domain {Streptococcus equisimilis [TaxId: 119602]}
inltgeevvalaakymnetdaafvkkaldyataahfyqvrksgepyivhpiqvagiladl
hldavtvacgflhdvvedtditldniefdfgkdvrdivdgvtklgkveyksheeqlaenh
rkmlmamskdirvilvkladrlhnmrtlkhlrkdkqerisretmeiyaplahrlgisrik
weledlafryln

Sequence, based on observed residues (ATOM records):

>d1vj7b1 a.211.1.1 (B:5-196) Stringent response-like protein RelA N-terminal domain {Streptococcus equisimilis [TaxId: 119602]}
inltgeevvalaakymnetdaafvkkaldyataahfyqvrksgepyivhpiqvagiladl
hldavtvacgflhdvvedtditldniefdfgkdvrdivdgvtklgkveskdirvilvkla
drlhnmrtlkhlrkdkqerisretmeiyaplahrlgisrikweledlafryln

Timeline for d1vj7b1:

• d1vj7b1 first appeared in SCOP 1.67
  
• d1vj7b1 appears in SCOPe 2.06
  
• d1vj7b1 appears in the current release, SCOPe 2.08