SCOP 1.73: Domain d1vj2a_: 1vj2 A:

Lineage for d1vj2a_ (1vj2 A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (20 families)

5. Family b.82.1.10: TM1459-like [101976] (2 proteins)

6. Protein Hypothetical protein TM1459 [101977] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [101978] (1 PDB entry)

8. Domain d1vj2a_: 1vj2 A: [100796]

Details for d1vj2a_

PDB Entry: 1vj2, 1.65 Å

PDB Description: crystal structure of a novel family of manganese-containing cupin (tm1459) from thermotoga maritima at 1.65 a resolution

PDB Compounds: (A:) novel manganese-containing cupin TM1459

SCOP Domain Sequences for d1vj2a_:

Sequence; same for both SEQRES and ATOM records:

>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]}
milkraydvtpqkistdkvrgvrkrvliglkdapnfvmrlftvepgglidrhshpwehei
fvlkgkltvlkeqgeetveegfyifvepneihgfrndtdseveflclipkegge

Timeline for d1vj2a_:

• d1vj2a_ first appeared in SCOP 1.67
  
• d1vj2a_ appears in SCOP 1.71
  
• d1vj2a_ appears in SCOP 1.75
  
• d1vj2a_ appears in the current release, SCOPe 2.08