SCOP 1.69: Domain d1vixb2: 1vix B:208-320

Lineage for d1vixb2 (1vix B:208-320)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family)

5. Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (5 proteins)

6. Protein Peptidase T (tripeptidase) [75443] (2 species)

7. Species Escherichia coli [TaxId:562] [103002] (1 PDB entry)

8. Domain d1vixb2: 1vix B:208-320 [100780]
   Other proteins in same PDB: d1vixa1, d1vixb1
   structural genomics

Details for d1vixb2

PDB Entry: 1vix, 2.5 Å

PDB Description: crystal structure of a putative peptidase t

SCOP Domain Sequences for d1vixb2:

Sequence; same for both SEQRES and ATOM records:

>d1vixb2 d.58.19.1 (B:208-320) Peptidase T (tripeptidase) {Escherichia coli}
fnaasvnikivgnnvhpgtakgvmvnalslaarihaevpadespemtegyegfyhlasmk
gtveradmhyiirdfdrkqfearkrkmmeiakkvgkglhpdcyielviedsyy

Timeline for d1vixb2:

• d1vixb2 first appeared in SCOP 1.67
  
• d1vixb2 appears in SCOP 1.71
  
• d1vixb2 appears in the current release, SCOPe 2.08