Lineage for d1vixa2 (1vix A:208-320)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 505109Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family) (S)
  5. 505110Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (5 proteins)
  6. 505120Protein Peptidase T (tripeptidase) [75443] (2 species)
  7. 505121Species Escherichia coli [TaxId:562] [103002] (1 PDB entry)
  8. 505122Domain d1vixa2: 1vix A:208-320 [100778]
    Other proteins in same PDB: d1vixa1, d1vixb1

Details for d1vixa2

PDB Entry: 1vix (more details), 2.5 Å

PDB Description: crystal structure of a putative peptidase t

SCOP Domain Sequences for d1vixa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vixa2 d.58.19.1 (A:208-320) Peptidase T (tripeptidase) {Escherichia coli}
fnaasvnikivgnnvhpgtakgvmvnalslaarihaevpadespemtegyegfyhlasmk
gtveradmhyiirdfdrkqfearkrkmmeiakkvgkglhpdcyielviedsyy

SCOP Domain Coordinates for d1vixa2:

Click to download the PDB-style file with coordinates for d1vixa2.
(The format of our PDB-style files is described here.)

Timeline for d1vixa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vixa1