Lineage for d1viob2 (1vio B:0-57)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1419099Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 1419100Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 1419193Family d.66.1.5: Pseudouridine synthase RsuA N-terminal domain [75468] (1 protein)
    automatically mapped to Pfam PF01479
  6. 1419194Protein Pseudouridine synthase RsuA N-terminal domain [75469] (2 species)
  7. 1419199Species Haemophilus influenzae [TaxId:727] [103049] (1 PDB entry)
  8. 1419201Domain d1viob2: 1vio B:0-57 [100765]
    Other proteins in same PDB: d1vioa1, d1viob1
    structural genomics
    complexed with bu1

Details for d1viob2

PDB Entry: 1vio (more details), 1.59 Å

PDB Description: crystal structure of pseudouridylate synthase
PDB Compounds: (B:) ribosomal small subunit pseudouridine synthase a

SCOPe Domain Sequences for d1viob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1viob2 d.66.1.5 (B:0-57) Pseudouridine synthase RsuA N-terminal domain {Haemophilus influenzae [TaxId: 727]}
slrldkfiaenvgltrsqatkairqsavkingeivksgsvqisqedeiyfedelltwi

SCOPe Domain Coordinates for d1viob2:

Click to download the PDB-style file with coordinates for d1viob2.
(The format of our PDB-style files is described here.)

Timeline for d1viob2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1viob1