Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta |
Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) common motif in otherwise different folds |
Family d.66.1.5: Pseudouridine synthase RsuA N-terminal domain [75468] (1 protein) |
Protein Pseudouridine synthase RsuA N-terminal domain [75469] (2 species) |
Species Haemophilus influenzae [TaxId:727] [103049] (1 PDB entry) |
Domain d1viob2: 1vio B:0-57 [100765] Other proteins in same PDB: d1vioa1, d1viob1 structural genomics complexed with bu1 |
PDB Entry: 1vio (more details), 1.59 Å
SCOPe Domain Sequences for d1viob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1viob2 d.66.1.5 (B:0-57) Pseudouridine synthase RsuA N-terminal domain {Haemophilus influenzae [TaxId: 727]} slrldkfiaenvgltrsqatkairqsavkingeivksgsvqisqedeiyfedelltwi
Timeline for d1viob2: