SCOPe 2.02: Domain d1viob1: 1vio B:58-231

Lineage for d1viob1 (1vio B:58-231)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
   consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold

4. Superfamily d.265.1: Pseudouridine synthase [55120] (4 families)
   the active site is the most conserved structural region of the superfamily and is located between the subdomains

5. Family d.265.1.3: Pseudouridine synthase RsuA/RluD [75459] (3 proteins)
   contains N-terminal alpha-L RNA-binding motif

6. Protein Ribosomal small subunit pseudouridine 516 synthase RsuA [75460] (2 species)

7. Species Haemophilus influenzae [TaxId:727] [103018] (1 PDB entry)

8. Domain d1viob1: 1vio B:58-231 [100764]
   Other proteins in same PDB: d1vioa2, d1viob2
   structural genomics
   complexed with bu1

Details for d1viob1

PDB Entry: 1vio, 1.59 Å

PDB Description: crystal structure of pseudouridylate synthase

PDB Compounds: (B:) ribosomal small subunit pseudouridine synthase a

SCOPe Domain Sequences for d1viob1:

Sequence, based on SEQRES records:

>d1viob1 d.265.1.3 (B:58-231) Ribosomal small subunit pseudouridine 516 synthase RsuA {Haemophilus influenzae [TaxId: 727]}
eegqyfmlnkpqgcvcsnddgdyptiyqffdyplagklhsagrldvdttglvlltddgqw
shritspkhhcektylvtladpveenysaacaegillrgekeptkpakleilddynvnlt
isegryhqvkrmfaalgnkvvglhrwkigdvvldesleegeyrpltqseieklv

Sequence, based on observed residues (ATOM records):

>d1viob1 d.265.1.3 (B:58-231) Ribosomal small subunit pseudouridine 516 synthase RsuA {Haemophilus influenzae [TaxId: 727]}
eegqyfmlnkpqgcvcsnddyptiyqffdyplagklhsagrldvdttglvlltddgqwsh
ritspkhhcektylvtladpveenysaacaegillrgekeptkpakleilddynvnltis
egryhqvkrmfaalgnkvvglhrwkigdvvldesleegeyrpltqseieklv

Timeline for d1viob1:

• d1viob1 first appeared in SCOP 1.67
  
• d1viob1 appears in SCOPe 2.01
  
• d1viob1 appears in SCOPe 2.03
  
• d1viob1 appears in the current release, SCOPe 2.08