Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.265: Pseudouridine synthase [100877] (1 superfamily) consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold |
Superfamily d.265.1: Pseudouridine synthase [55120] (4 families) the active site is the most conserved structural region of the superfamily and is located between the subdomains |
Family d.265.1.3: Pseudouridine synthase RsuA/RluD [75459] (3 proteins) contains N-terminal alpha-L RNA-binding motif |
Protein Ribosomal small subunit pseudouridine 516 synthase RsuA [75460] (2 species) |
Species Haemophilus influenzae [TaxId:727] [103018] (1 PDB entry) |
Domain d1vioa1: 1vio A:58-231 [100762] Other proteins in same PDB: d1vioa2, d1viob2 |
PDB Entry: 1vio (more details), 1.59 Å
SCOP Domain Sequences for d1vioa1:
Sequence, based on SEQRES records: (download)
>d1vioa1 d.265.1.3 (A:58-231) Ribosomal small subunit pseudouridine 516 synthase RsuA {Haemophilus influenzae [TaxId: 727]} eegqyfmlnkpqgcvcsnddgdyptiyqffdyplagklhsagrldvdttglvlltddgqw shritspkhhcektylvtladpveenysaacaegillrgekeptkpakleilddynvnlt isegryhqvkrmfaalgnkvvglhrwkigdvvldesleegeyrpltqseieklv
>d1vioa1 d.265.1.3 (A:58-231) Ribosomal small subunit pseudouridine 516 synthase RsuA {Haemophilus influenzae [TaxId: 727]} eegqyfmlnkpqgcvcsnddyptiyqffdyplagklhsagrldvdttglvlltddgqwsh ritspkhhcektylvtladpveenysaacaegillrgekeptkpakleilddynvnltis egryhqvkrmfaalgnkvvglhrwkigdvvldesleegeyrpltqseieklv
Timeline for d1vioa1: