Lineage for d1vioa1 (1vio A:58-231)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741101Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 741102Superfamily d.265.1: Pseudouridine synthase [55120] (4 families) (S)
    the active site is the most conserved structural region of the superfamily and is located between the subdomains
  5. 741141Family d.265.1.3: Pseudouridine synthase RsuA/RluD [75459] (3 proteins)
    contains N-terminal alpha-L RNA-binding motif
  6. 741151Protein Ribosomal small subunit pseudouridine 516 synthase RsuA [75460] (2 species)
  7. 741156Species Haemophilus influenzae [TaxId:727] [103018] (1 PDB entry)
  8. 741157Domain d1vioa1: 1vio A:58-231 [100762]
    Other proteins in same PDB: d1vioa2, d1viob2

Details for d1vioa1

PDB Entry: 1vio (more details), 1.59 Å

PDB Description: crystal structure of pseudouridylate synthase
PDB Compounds: (A:) ribosomal small subunit pseudouridine synthase a

SCOP Domain Sequences for d1vioa1:

Sequence, based on SEQRES records: (download)

>d1vioa1 d.265.1.3 (A:58-231) Ribosomal small subunit pseudouridine 516 synthase RsuA {Haemophilus influenzae [TaxId: 727]}
eegqyfmlnkpqgcvcsnddgdyptiyqffdyplagklhsagrldvdttglvlltddgqw
shritspkhhcektylvtladpveenysaacaegillrgekeptkpakleilddynvnlt
isegryhqvkrmfaalgnkvvglhrwkigdvvldesleegeyrpltqseieklv

Sequence, based on observed residues (ATOM records): (download)

>d1vioa1 d.265.1.3 (A:58-231) Ribosomal small subunit pseudouridine 516 synthase RsuA {Haemophilus influenzae [TaxId: 727]}
eegqyfmlnkpqgcvcsnddyptiyqffdyplagklhsagrldvdttglvlltddgqwsh
ritspkhhcektylvtladpveenysaacaegillrgekeptkpakleilddynvnltis
egryhqvkrmfaalgnkvvglhrwkigdvvldesleegeyrpltqseieklv

SCOP Domain Coordinates for d1vioa1:

Click to download the PDB-style file with coordinates for d1vioa1.
(The format of our PDB-style files is described here.)

Timeline for d1vioa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vioa2