SCOP 1.67: Domain d1vioa1: 1vio A:58-231

Lineage for d1vioa1 (1vio A:58-231)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
   consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold

4. Superfamily d.265.1: Pseudouridine synthase [55120] (4 families)
   the active site is the most conserved structural region of the superfamily and is located between the subdomains

5. Family d.265.1.3: Pseudouridine synthase RsuA/RluD [75459] (2 proteins)
   contains N-terminal alpha-L RNA-binding motif

6. Protein Ribosomal small subunit pseudouridine 516 synthase RsuA [75460] (2 species)

7. Species Haemophilus influenzae [TaxId:727] [103018] (1 PDB entry)

8. Domain d1vioa1: 1vio A:58-231 [100762]
   Other proteins in same PDB: d1vioa2, d1viob2

Details for d1vioa1

PDB Entry: 1vio, 1.59 Å

PDB Description: crystal structure of pseudouridylate synthase

SCOP Domain Sequences for d1vioa1:

Sequence, based on SEQRES records:

>d1vioa1 d.265.1.3 (A:58-231) Ribosomal small subunit pseudouridine 516 synthase RsuA {Haemophilus influenzae}
eegqyfmlnkpqgcvcsnddgdyptiyqffdyplagklhsagrldvdttglvlltddgqw
shritspkhhcektylvtladpveenysaacaegillrgekeptkpakleilddynvnlt
isegryhqvkrmfaalgnkvvglhrwkigdvvldesleegeyrpltqseieklv

Sequence, based on observed residues (ATOM records):

>d1vioa1 d.265.1.3 (A:58-231) Ribosomal small subunit pseudouridine 516 synthase RsuA {Haemophilus influenzae}
eegqyfmlnkpqgcvcsnddyptiyqffdyplagklhsagrldvdttglvlltddgqwsh
ritspkhhcektylvtladpveenysaacaegillrgekeptkpakleilddynvnltis
egryhqvkrmfaalgnkvvglhrwkigdvvldesleegeyrpltqseieklv

Timeline for d1vioa1:

• d1vioa1 is new in SCOP 1.67
  
• d1vioa1 appears in SCOP 1.69
  
• d1vioa1 appears in the current release, SCOPe 2.08