Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (5 families) |
Family d.38.1.5: PaaI/YdiI-like [89902] (6 proteins) |
Protein Hypothetical protein YdiI [102910] (1 species) |
Species Escherichia coli [TaxId:562] [102911] (3 PDB entries) |
Domain d1vi8g_: 1vi8 G: [100748] |
PDB Entry: 1vi8 (more details), 2.2 Å
SCOP Domain Sequences for d1vi8g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vi8g_ d.38.1.5 (G:) Hypothetical protein YdiI {Escherichia coli} liwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasvv laesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieifd ekgrlccssrlttaile
Timeline for d1vi8g_: