| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) ![]() |
| Family d.58.11.2: YigZ C-terminal domain-like [102991] (2 proteins) similar to EF-G domain V; N-terminal domain shares structural similarity with the EF-G domain IV |
| Protein Hypothetical protein YigZ, C-terminal domain [102992] (1 species) |
| Species Escherichia coli [TaxId:562] [102993] (1 PDB entry) |
| Domain d1vi7a2: 1vi7 A:138-208 [100741] Other proteins in same PDB: d1vi7a1 structural genomics |
PDB Entry: 1vi7 (more details), 2.8 Å
SCOPe Domain Sequences for d1vi7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vi7a2 d.58.11.2 (A:138-208) Hypothetical protein YigZ, C-terminal domain {Escherichia coli [TaxId: 562]}
plteytlqceyhqltgieallgqcdgkiinsdyqafvllrvalpaakvaefsakladfsr
gslqllaieee
Timeline for d1vi7a2: