| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
| Family d.14.1.11: YigZ N-terminal domain-like [102772] (2 proteins) modification of the common fold; contains extra alpha-beta unit after strand 2, the extra strand is inserted between strands 3 and 4 automatically mapped to Pfam PF01205 |
| Protein Hypothetical protein YigZ, N-terminal domain [102773] (1 species) |
| Species Escherichia coli [TaxId:562] [102774] (1 PDB entry) two-domain structure is similar to the C-terminal region of EF-G (domains IV and V) |
| Domain d1vi7a1: 1vi7 A:4-137 [100740] Other proteins in same PDB: d1vi7a2, d1vi7a3, d1vi7a4 structural genomics |
PDB Entry: 1vi7 (more details), 2.8 Å
SCOPe Domain Sequences for d1vi7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vi7a1 d.14.1.11 (A:4-137) Hypothetical protein YigZ, N-terminal domain {Escherichia coli [TaxId: 562]}
meswlipaapvtvveeikksrfitmlahtdgveaakafvesvraehpdarhhcvawvaga
pddsqqlgfsddgepagtagkpmlaqlmgsgvgeitavvvryyggillgtgglvkayggg
vnqalrqlttqrkt
Timeline for d1vi7a1: