Lineage for d1vi5b_ (1vi5 B:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 826781Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
    fold elaborated with additional structures
  5. 826782Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 826783Protein Ribosomal protein S2 [52315] (3 species)
  7. 826784Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [102246] (2 PDB entries)
  8. 826790Domain d1vi5b_: 1vi5 B: [100733]
    structural genomics

Details for d1vi5b_

PDB Entry: 1vi5 (more details), 2.65 Å

PDB Description: crystal structure of ribosomal protein s2p
PDB Compounds: (B:) 30S ribosomal protein S2P

SCOP Domain Sequences for d1vi5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vi5b_ c.23.15.1 (B:) Ribosomal protein S2 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
keyeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaakfls
ryepskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvfvndp
aidkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareiakirg
qdftysiedfeaele

SCOP Domain Coordinates for d1vi5b_:

Click to download the PDB-style file with coordinates for d1vi5b_.
(The format of our PDB-style files is described here.)

Timeline for d1vi5b_: