SCOPe 2.04: Domain d1vi4a_: 1vi4 A:

Lineage for d1vi4a_ (1vi4 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.7: RraA-like [89562] (2 families)
   structural similarity and possible distant homology to the phosphohistidine domain of pyruvate phosphate dikinase

5. Family c.8.7.1: RraA-like [89563] (5 proteins)
   aka MenG-like; characterized as regulator of RNase E activity A (RraA) that globally modulates RNA abundance in E. coli
   automatically mapped to Pfam PF03737

6. Protein Hypothetical protein VC2366 [102194] (1 species)
   RraA homologue

7. Species Vibrio cholerae [TaxId:666] [102195] (1 PDB entry)

8. Domain d1vi4a_: 1vi4 A: [100731]
   structural genomics

Details for d1vi4a_

PDB Entry: 1vi4, 1.87 Å

PDB Description: crystal structure of regulator of ribonuclease activity a protein 1

PDB Compounds: (A:) Regulator of ribonuclease acivity A protein 1

SCOPe Domain Sequences for d1vi4a_:

Sequence; same for both SEQRES and ATOM records:

>d1vi4a_ c.8.7.1 (A:) Hypothetical protein VC2366 {Vibrio cholerae [TaxId: 666]}
mrditpdlcdkyesqvtllnlplqnfgqrsafwgeivtvrcyhdnskvrdvlsqngkgkv
lvvdghgschkalmgdqlailaikndwegviiygavrdvvamsemdlgikalgtspfkte
krgagqvnvtltmqnqivepgdylyadwngilmsetaldvae

Timeline for d1vi4a_:

• d1vi4a_ first appeared in SCOP 1.67
  
• d1vi4a_ appears in SCOPe 2.03
  
• d1vi4a_ appears in SCOPe 2.05
  
• d1vi4a_ appears in the current release, SCOPe 2.08, called d1vi4a1