Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.7: RraA-like [89562] (2 families) structural similarity and possible distant homology to the phosphohistidine domain of pyruvate phosphate dikinase |
Family c.8.7.1: RraA-like [89563] (5 proteins) aka MenG-like; characterized as regulator of RNase E activity A (RraA) that globally modulates RNA abundance in E. coli automatically mapped to Pfam PF03737 |
Protein Hypothetical protein VC2366 [102194] (1 species) RraA homologue |
Species Vibrio cholerae [TaxId:666] [102195] (1 PDB entry) |
Domain d1vi4a_: 1vi4 A: [100731] structural genomics |
PDB Entry: 1vi4 (more details), 1.87 Å
SCOPe Domain Sequences for d1vi4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vi4a_ c.8.7.1 (A:) Hypothetical protein VC2366 {Vibrio cholerae [TaxId: 666]} mrditpdlcdkyesqvtllnlplqnfgqrsafwgeivtvrcyhdnskvrdvlsqngkgkv lvvdghgschkalmgdqlailaikndwegviiygavrdvvamsemdlgikalgtspfkte krgagqvnvtltmqnqivepgdylyadwngilmsetaldvae
Timeline for d1vi4a_: