SCOP 1.73: Domain d1vhxb_: 1vhx B:

Lineage for d1vhxb_ (1vhx B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (12 families)
   consists of one domain of this fold

5. Family c.55.3.8: Putative Holliday junction resolvase RuvX [102485] (3 proteins)

6. Protein Hypothetical protein YrrK (RuvX) [102488] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [102489] (1 PDB entry)

8. Domain d1vhxb_: 1vhx B: [100713]
   structural genomics

Details for d1vhxb_

PDB Entry: 1vhx, 1.96 Å

PDB Description: crystal structure of putative holliday junction resolvase

PDB Compounds: (B:) Putative Holliday junction resolvase

SCOP Domain Sequences for d1vhxb_:

Sequence; same for both SEQRES and ATOM records:

>d1vhxb_ c.55.3.8 (B:) Hypothetical protein YrrK (RuvX) {Bacillus subtilis [TaxId: 1423]}
slrilgldlgtktlgvalsdemgwtaqgietikineaegdyglsrlselikdytidkivl
gfpknmngtvgprgeasqtfakvlettynvpvvlwderlttmaaekmliaadvsrqkrkk
vidkmaavmilqgyldsl

Timeline for d1vhxb_:

• d1vhxb_ first appeared in SCOP 1.67
  
• d1vhxb_ appears in SCOP 1.71
  
• d1vhxb_ appears in SCOP 1.75
  
• d1vhxb_ appears in the current release, SCOPe 2.08, called d1vhxb1