Lineage for d1vhoa1 (1vho A:70-152)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 562760Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 562925Superfamily b.49.3: Aminopeptidase/glucanase lid domain [101821] (1 family) (S)
  5. 562926Family b.49.3.1: Aminopeptidase/glucanase lid domain [101822] (4 proteins)
  6. 562939Protein Putative endoglucanase TM1048 [101825] (1 species)
  7. 562940Species Thermotoga maritima [TaxId:243274] [101826] (1 PDB entry)
  8. 562941Domain d1vhoa1: 1vho A:70-152 [100694]
    Other proteins in same PDB: d1vhoa2
    structural genomics
    complexed with cac, so4

Details for d1vhoa1

PDB Entry: 1vho (more details), 1.86 Å

PDB Description: crystal structure of a putative peptidase/endoglucanase

SCOP Domain Sequences for d1vhoa1:

Sequence, based on SEQRES records: (download)

>d1vhoa1 b.49.3.1 (A:70-152) Putative endoglucanase TM1048 {Thermotoga maritima}
gfvvskvegqfarlepvggvdpkvvyaskvriytkngiergvigmlaphlqdsesrkkvp
tydeifvdlslcergvrvgdiav

Sequence, based on observed residues (ATOM records): (download)

>d1vhoa1 b.49.3.1 (A:70-152) Putative endoglucanase TM1048 {Thermotoga maritima}
gfvvskvegqfarlepvyaskvriytkngiergvigmlaphlqdsesrkkvptydeifvd
lslcergvrvgdiav

SCOP Domain Coordinates for d1vhoa1:

Click to download the PDB-style file with coordinates for d1vhoa1.
(The format of our PDB-style files is described here.)

Timeline for d1vhoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vhoa2