Lineage for d1vhkd2 (1vhk D:74-253)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1629957Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 1629958Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 1630042Family c.116.1.5: YggJ C-terminal domain-like [89632] (4 proteins)
    contains extra strand (3) in the parallel beta-sheet, order 321546; similar dimerisation to the MTH1 domain
  6. 1630057Protein Hypothetical protein YqeU [102281] (1 species)
  7. 1630058Species Bacillus subtilis [TaxId:1423] [102282] (1 PDB entry)
  8. 1630062Domain d1vhkd2: 1vhk D:74-253 [100687]
    Other proteins in same PDB: d1vhka1, d1vhkb1, d1vhkc1, d1vhkd1
    structural genomics

Details for d1vhkd2

PDB Entry: 1vhk (more details), 2.6 Å

PDB Description: crystal structure of an hypothetical protein
PDB Compounds: (D:) Hypothetical protein yqeU

SCOPe Domain Sequences for d1vhkd2:

Sequence, based on SEQRES records: (download)

>d1vhkd2 c.116.1.5 (D:74-253) Hypothetical protein YqeU {Bacillus subtilis [TaxId: 1423]}
nrelpikvyiasglpkgdklewiiqkgtelgahafipfqaarsvvklddkkakkkrerwt
kiakeaaeqsyrnevprvmdvhsfqqllqrmqdfdkcvvayeesskqgeisafsaivssl
pkgssllivfgpegglteaeverlteqdgvtcglgprilrtetaplyalsaisyqtellr

Sequence, based on observed residues (ATOM records): (download)

>d1vhkd2 c.116.1.5 (D:74-253) Hypothetical protein YqeU {Bacillus subtilis [TaxId: 1423]}
nrelpikvyiasglpkgdklewiiqkgtelgahafipfqaarsvkrerwtkiakeaaeqs
yrnevprvmdvhsfqqllqrmqdfdkcvvayeesafsaivsslpkgssllivfgpegglt
eaeverlteqdgvtcglgprilrtetaplyalsaisyqtellr

SCOPe Domain Coordinates for d1vhkd2:

Click to download the PDB-style file with coordinates for d1vhkd2.
(The format of our PDB-style files is described here.)

Timeline for d1vhkd2: