| Class b: All beta proteins [48724] (176 folds) |
| Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (14 families) ![]() |
| Family b.122.1.2: YggJ N-terminal domain-like [89451] (3 proteins) |
| Protein Hypothetical protein YqeU [102028] (1 species) |
| Species Bacillus subtilis [TaxId:1423] [102029] (1 PDB entry) |
| Domain d1vhkd1: 1vhk D:2-73 [100686] Other proteins in same PDB: d1vhka2, d1vhkb2, d1vhkc2, d1vhkd2 structural genomics; domains of B and D chains are partly disordered |
PDB Entry: 1vhk (more details), 2.6 Å
SCOPe Domain Sequences for d1vhkd1:
Sequence, based on SEQRES records: (download)
>d1vhkd1 b.122.1.2 (D:2-73) Hypothetical protein YqeU {Bacillus subtilis [TaxId: 1423]}
qryfieltkqqieeaptfsitgeevhhivnvmrmnegdqiiccsqdgfeakcelqsvskd
kvsclviewtne
>d1vhkd1 b.122.1.2 (D:2-73) Hypothetical protein YqeU {Bacillus subtilis [TaxId: 1423]}
qryficcsqdgfeae
Timeline for d1vhkd1: