Lineage for d1vhkb1 (1vhk B:2-73)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1564510Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 1564511Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 1564561Family b.122.1.2: YggJ N-terminal domain-like [89451] (3 proteins)
  6. 1564574Protein Hypothetical protein YqeU [102028] (1 species)
  7. 1564575Species Bacillus subtilis [TaxId:1423] [102029] (1 PDB entry)
  8. 1564577Domain d1vhkb1: 1vhk B:2-73 [100682]
    Other proteins in same PDB: d1vhka2, d1vhkb2, d1vhkc2, d1vhkd2
    structural genomics; domains of B and D chains are partly disordered

Details for d1vhkb1

PDB Entry: 1vhk (more details), 2.6 Å

PDB Description: crystal structure of an hypothetical protein
PDB Compounds: (B:) Hypothetical protein yqeU

SCOPe Domain Sequences for d1vhkb1:

Sequence, based on SEQRES records: (download)

>d1vhkb1 b.122.1.2 (B:2-73) Hypothetical protein YqeU {Bacillus subtilis [TaxId: 1423]}
qryfieltkqqieeaptfsitgeevhhivnvmrmnegdqiiccsqdgfeakcelqsvskd
kvsclviewtne

Sequence, based on observed residues (ATOM records): (download)

>d1vhkb1 b.122.1.2 (B:2-73) Hypothetical protein YqeU {Bacillus subtilis [TaxId: 1423]}
qryfieltkqiiccsqdgfeakcclviewtne

SCOPe Domain Coordinates for d1vhkb1:

Click to download the PDB-style file with coordinates for d1vhkb1.
(The format of our PDB-style files is described here.)

Timeline for d1vhkb1: