SCOP 1.71: Domain d1vhea1: 1vhe A:73-162

Lineage for d1vhea1 (1vhe A:73-162)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.3: Aminopeptidase/glucanase lid domain [101821] (1 family)

5. Family b.49.3.1: Aminopeptidase/glucanase lid domain [101822] (4 proteins)

6. Protein Hypothetical protein YsdC [101823] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [101824] (1 PDB entry)

8. Domain d1vhea1: 1vhe A:73-162 [100669]
   Other proteins in same PDB: d1vhea2
   structural genomics
   complexed with zn

Details for d1vhea1

PDB Entry: 1vhe, 1.9 Å

PDB Description: Crystal structure of a aminopeptidase/glucanase homolog

SCOP Domain Sequences for d1vhea1:

Sequence; same for both SEQRES and ATOM records:

>d1vhea1 b.49.3.1 (A:73-162) Hypothetical protein YsdC {Bacillus subtilis}
gfmvtqitdkgfirfqtvggwwaqvmlaqrvtivtkkgeitgvigskpphilspearkks
veikdmfidigassreealewgvlpgdmiv

Timeline for d1vhea1:

• d1vhea1 first appeared in SCOP 1.67
  
• d1vhea1 appears in SCOP 1.69
  
• d1vhea1 appears in SCOP 1.73
  
• d1vhea1 appears in the current release, SCOPe 2.08