Lineage for d1vf5s_ (1vf5 S:)

  1. Root: SCOP 1.71
  2. 619386Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)
  3. 620228Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 620622Superfamily f.23.25: PetM subunit of the cytochrome b6f complex [103441] (1 family) (S)
  5. 620623Family f.23.25.1: PetM subunit of the cytochrome b6f complex [103442] (1 protein)
  6. 620624Protein PetM subunit of the cytochrome b6f complex [103443] (2 species)
  7. 620627Species Mastigocladus laminosus [TaxId:83541] [103444] (1 PDB entry)
  8. 620629Domain d1vf5s_: 1vf5 S: [100597]
    Other proteins in same PDB: d1vf5a_, d1vf5b_, d1vf5c1, d1vf5c2, d1vf5c3, d1vf5d1, d1vf5d2, d1vf5e_, d1vf5g_, d1vf5h_, d1vf5n_, d1vf5o_, d1vf5p1, d1vf5p2, d1vf5p3, d1vf5q1, d1vf5q2, d1vf5r_, d1vf5t_, d1vf5u_
    complexed with bcr, cla, fes, hem, opc, pl9, tds

Details for d1vf5s_

PDB Entry: 1vf5 (more details), 3 Å

PDB Description: Crystal Structure of Cytochrome b6f Complex from M.laminosus

SCOP Domain Sequences for d1vf5s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vf5s_ f.23.25.1 (S:) PetM subunit of the cytochrome b6f complex {Mastigocladus laminosus}
mteemlyaallsfglifvgwglgvlllkiqgaeke

SCOP Domain Coordinates for d1vf5s_:

Click to download the PDB-style file with coordinates for d1vf5s_.
(The format of our PDB-style files is described here.)

Timeline for d1vf5s_: