Lineage for d1vf5r_ (1vf5 R:)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 519895Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 520281Superfamily f.23.24: PetL subunit of the cytochrome b6f complex [103436] (1 family) (S)
  5. 520282Family f.23.24.1: PetL subunit of the cytochrome b6f complex [103437] (1 protein)
  6. 520283Protein PetL subunit of the cytochrome b6f complex [103438] (2 species)
  7. 520286Species Mastigocladus laminosus [TaxId:83541] [103439] (1 PDB entry)
  8. 520288Domain d1vf5r_: 1vf5 R: [100596]
    Other proteins in same PDB: d1vf5a_, d1vf5b_, d1vf5c1, d1vf5c2, d1vf5c3, d1vf5d1, d1vf5d2, d1vf5f_, d1vf5g_, d1vf5h_, d1vf5n_, d1vf5o_, d1vf5p1, d1vf5p2, d1vf5p3, d1vf5q1, d1vf5q2, d1vf5s_, d1vf5t_, d1vf5u_

Details for d1vf5r_

PDB Entry: 1vf5 (more details), 3 Å

PDB Description: Crystal Structure of Cytochrome b6f Complex from M.laminosus

SCOP Domain Sequences for d1vf5r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vf5r_ f.23.24.1 (R:) PetL subunit of the cytochrome b6f complex {Mastigocladus laminosus}
milgavfyivfialffgiavgiifaiksikli

SCOP Domain Coordinates for d1vf5r_:

Click to download the PDB-style file with coordinates for d1vf5r_.
(The format of our PDB-style files is described here.)

Timeline for d1vf5r_: