| Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
| Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family) ![]() |
| Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins) |
| Protein ISP subunit from the cytochrome b6f complex, transmembrane anchor [103428] (2 species) |
| Species Mastigocladus laminosus [TaxId:83541] [103429] (5 PDB entries) |
| Domain d1vf5q2: 1vf5 Q:12-45 [100595] Other proteins in same PDB: d1vf5a_, d1vf5b_, d1vf5c1, d1vf5c2, d1vf5c3, d1vf5d1, d1vf5e_, d1vf5f_, d1vf5g_, d1vf5h_, d1vf5n_, d1vf5o_, d1vf5p1, d1vf5p2, d1vf5p3, d1vf5q1, d1vf5r_, d1vf5s_, d1vf5t_, d1vf5u_ complexed with bcr, cla, fes, hem, opc, pl9, tds |
PDB Entry: 1vf5 (more details), 3 Å
SCOP Domain Sequences for d1vf5q2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vf5q2 f.23.12.1 (Q:12-45) ISP subunit from the cytochrome b6f complex, transmembrane anchor {Mastigocladus laminosus [TaxId: 83541]}
dmgrrqfmnllafgtvtgvalgalyplvkyfipp
Timeline for d1vf5q2: