Lineage for d1vf5q2 (1vf5 Q:12-45)

  1. Root: SCOP 1.71
  2. 619386Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)
  3. 620228Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 620462Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family) (S)
  5. 620463Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)
  6. 620491Protein ISP subunit from the cytochrome b6f complex, transmembrane anchor [103428] (2 species)
  7. 620494Species Mastigocladus laminosus [TaxId:83541] [103429] (1 PDB entry)
  8. 620496Domain d1vf5q2: 1vf5 Q:12-45 [100595]
    Other proteins in same PDB: d1vf5a_, d1vf5b_, d1vf5c1, d1vf5c2, d1vf5c3, d1vf5d1, d1vf5e_, d1vf5f_, d1vf5g_, d1vf5h_, d1vf5n_, d1vf5o_, d1vf5p1, d1vf5p2, d1vf5p3, d1vf5q1, d1vf5r_, d1vf5s_, d1vf5t_, d1vf5u_
    complexed with bcr, cla, fes, hem, opc, pl9, tds

Details for d1vf5q2

PDB Entry: 1vf5 (more details), 3 Å

PDB Description: Crystal Structure of Cytochrome b6f Complex from M.laminosus

SCOP Domain Sequences for d1vf5q2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vf5q2 f.23.12.1 (Q:12-45) ISP subunit from the cytochrome b6f complex, transmembrane anchor {Mastigocladus laminosus}
dmgrrqfmnllafgtvtgvalgalyplvkyfipp

SCOP Domain Coordinates for d1vf5q2:

Click to download the PDB-style file with coordinates for d1vf5q2.
(The format of our PDB-style files is described here.)

Timeline for d1vf5q2: