SCOP 1.71: Domain d1vf5q1: 1vf5 Q:46-179

Lineage for d1vf5q1 (1vf5 Q:46-179)

Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds)

Fold b.33: ISP domain [50021] (1 superfamily)
consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

Superfamily b.33.1: ISP domain [50022] (2 families)
Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (8 proteins)
Protein ISP subunit from the cytochrome b6f complex, soluble domain [101665] (2 species)
Species Mastigocladus laminosus [TaxId:83541] [101666] (1 PDB entry)

Domain d1vf5q1: 1vf5 Q:46-179 [100594]
Other proteins in same PDB: d1vf5a_, d1vf5b_, d1vf5c1, d1vf5c2, d1vf5c3, d1vf5d2, d1vf5e_, d1vf5f_, d1vf5g_, d1vf5h_, d1vf5n_, d1vf5o_, d1vf5p1, d1vf5p2, d1vf5p3, d1vf5q2, d1vf5r_, d1vf5s_, d1vf5t_, d1vf5u_
complexed with bcr, cla, fes, hem, opc, pl9, tds

Details for d1vf5q1

PDB Entry: 1vf5 (more details), 3 Å

PDB Description: Crystal Structure of Cytochrome b6f Complex from M.laminosus

SCOP Domain Sequences for d1vf5q1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vf5q1 b.33.1.1 (Q:46-179) ISP subunit from the cytochrome b6f complex, soluble domain {Mastigocladus laminosus}
sggavgggttakdklgnnvkvskfleshnagdrvlvqglkgdptyivveskeairdygin
avcthlgcvvpwnaaenkfkcpchgsqydetgrvirgpaplslalchatvqddnivltpw
tetdfrtgekpwwv

SCOP Domain Coordinates for d1vf5q1:

Click to download the PDB-style file with coordinates for d1vf5q1.
(The format of our PDB-style files is described here.)

Timeline for d1vf5q1: