![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (40 superfamilies) not a true fold |
![]() | Superfamily f.23.23: Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor [103431] (1 family) ![]() |
![]() | Family f.23.23.1: Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor [103432] (1 protein) |
![]() | Protein Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor [103433] (2 species) |
![]() | Species Mastigocladus laminosus [TaxId:83541] [103434] (2 PDB entries) |
![]() | Domain d1vf5p3: 1vf5 P:250-286 [100593] Other proteins in same PDB: d1vf5a_, d1vf5b_, d1vf5c1, d1vf5c2, d1vf5d1, d1vf5d2, d1vf5e_, d1vf5f_, d1vf5g_, d1vf5h_, d1vf5n_, d1vf5o_, d1vf5p1, d1vf5p2, d1vf5q1, d1vf5q2, d1vf5r_, d1vf5s_, d1vf5t_, d1vf5u_ complexed with bcr, cla, fes, hem, opc, pl9, tds |
PDB Entry: 1vf5 (more details), 3 Å
SCOPe Domain Sequences for d1vf5p3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vf5p3 f.23.23.1 (P:250-286) Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor {Mastigocladus laminosus [TaxId: 83541]} qdpnrvkwmiaficlvmlaqlmlilkkkqvekvqaae
Timeline for d1vf5p3: