SCOP 1.71: Domain d1vf5p3: 1vf5 P:250-286

Lineage for d1vf5p3 (1vf5 P:250-286)

1. Root: SCOP 1.71

2. Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.23: Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor [103431] (1 family)

5. Family f.23.23.1: Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor [103432] (1 protein)

6. Protein Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor [103433] (2 species)

7. Species Mastigocladus laminosus [TaxId:83541] [103434] (1 PDB entry)

8. Domain d1vf5p3: 1vf5 P:250-286 [100593]
   Other proteins in same PDB: d1vf5a_, d1vf5b_, d1vf5c1, d1vf5c2, d1vf5d1, d1vf5d2, d1vf5e_, d1vf5f_, d1vf5g_, d1vf5h_, d1vf5n_, d1vf5o_, d1vf5p1, d1vf5p2, d1vf5q1, d1vf5q2, d1vf5r_, d1vf5s_, d1vf5t_, d1vf5u_
   complexed with bcr, cla, fes, hem, opc, pl9, tds

Details for d1vf5p3

PDB Entry: 1vf5, 3 Å

PDB Description: Crystal Structure of Cytochrome b6f Complex from M.laminosus

SCOP Domain Sequences for d1vf5p3:

Sequence; same for both SEQRES and ATOM records:

>d1vf5p3 f.23.23.1 (P:250-286) Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor {Mastigocladus laminosus}
qdpnrvkwmiaficlvmlaqlmlilkkkqvekvqaae

Timeline for d1vf5p3:

• d1vf5p3 first appeared in SCOP 1.67
  
• d1vf5p3 appears in SCOP 1.69
  
• d1vf5p3 appears in SCOP 1.73
  
• d1vf5p3 appears in the current release, SCOPe 2.08