Lineage for d1vf5p2 (1vf5 P:170-231)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1139355Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1139429Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) (S)
  5. 1139490Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein)
  6. 1139491Protein Cytochrome f, small domain [51257] (5 species)
  7. 1139508Species Mastigocladus laminosus [TaxId:83541] [102005] (1 PDB entry)
  8. 1139510Domain d1vf5p2: 1vf5 P:170-231 [100592]
    Other proteins in same PDB: d1vf5a_, d1vf5b_, d1vf5c1, d1vf5c3, d1vf5d1, d1vf5d2, d1vf5e_, d1vf5f_, d1vf5g_, d1vf5h_, d1vf5n_, d1vf5o_, d1vf5p1, d1vf5p3, d1vf5q1, d1vf5q2, d1vf5r_, d1vf5s_, d1vf5t_, d1vf5u_
    complexed with bcr, cla, fes, hem, opc, pl9, tds

Details for d1vf5p2

PDB Entry: 1vf5 (more details), 3 Å

PDB Description: Crystal Structure of Cytochrome b6f Complex from M.laminosus
PDB Compounds: (P:) cytochrome f

SCOPe Domain Sequences for d1vf5p2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vf5p2 b.84.2.2 (P:170-231) Cytochrome f, small domain {Mastigocladus laminosus [TaxId: 83541]}
nvftasatgtitkiakeedeygnvkyqvsiqtdsgktvvdtipagpelivsegqavkage
al

SCOPe Domain Coordinates for d1vf5p2:

Click to download the PDB-style file with coordinates for d1vf5p2.
(The format of our PDB-style files is described here.)

Timeline for d1vf5p2: