Lineage for d1vf5p1 (1vf5 P:1-169,P:232-249)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 368237Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 368562Superfamily b.2.6: Cytochrome f, large domain [49441] (1 family) (S)
  5. 368563Family b.2.6.1: Cytochrome f, large domain [49442] (1 protein)
  6. 368564Protein Cytochrome f, large domain [49443] (4 species)
    this domain is interrupted by a small domain which is barrel-sandwich hybrid fold
  7. 368581Species Mastigocladus laminosus [TaxId:83541] [101556] (1 PDB entry)
  8. 368583Domain d1vf5p1: 1vf5 P:1-169,P:232-249 [100591]
    Other proteins in same PDB: d1vf5a_, d1vf5b_, d1vf5c2, d1vf5c3, d1vf5d1, d1vf5d2, d1vf5e_, d1vf5f_, d1vf5g_, d1vf5h_, d1vf5n_, d1vf5o_, d1vf5p2, d1vf5p3, d1vf5q1, d1vf5q2, d1vf5r_, d1vf5s_, d1vf5t_, d1vf5u_
    complexed with bcr, cla, fes, hem, opc, pl9, tds

Details for d1vf5p1

PDB Entry: 1vf5 (more details), 3 Å

PDB Description: Crystal Structure of Cytochrome b6f Complex from M.laminosus

SCOP Domain Sequences for d1vf5p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vf5p1 b.2.6.1 (P:1-169,P:232-249) Cytochrome f, large domain {Mastigocladus laminosus}
ypfwaqqtypptpreptgrivcanchlaakpaevevpqsvlpdtvfkavvkipydtklqq
vaadgskvglnvgavlmlpegfkiapeeripeelkkevgdvyfqpykegqdnvllvgplp
geqyqeivfpvlspnpttdknihfgkyaihlganrgrgqiyptgeksnnXtnnpnvggfg
qddteivl

SCOP Domain Coordinates for d1vf5p1:

Click to download the PDB-style file with coordinates for d1vf5p1.
(The format of our PDB-style files is described here.)

Timeline for d1vf5p1: