Lineage for d1vf5n_ (1vf5 N:)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 519804Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 519805Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 519811Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (2 proteins)
    a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 519812Protein Cytochrome b6 subunit of the cytochrome b6f complex [103498] (2 species)
  7. 519815Species Mastigocladus laminosus [TaxId:83541] [103499] (1 PDB entry)
  8. 519817Domain d1vf5n_: 1vf5 N: [100589]
    Other proteins in same PDB: d1vf5b_, d1vf5c1, d1vf5c2, d1vf5c3, d1vf5d1, d1vf5d2, d1vf5e_, d1vf5f_, d1vf5g_, d1vf5h_, d1vf5o_, d1vf5p1, d1vf5p2, d1vf5p3, d1vf5q1, d1vf5q2, d1vf5r_, d1vf5s_, d1vf5t_, d1vf5u_

Details for d1vf5n_

PDB Entry: 1vf5 (more details), 3 Å

PDB Description: Crystal Structure of Cytochrome b6f Complex from M.laminosus

SCOP Domain Sequences for d1vf5n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vf5n_ f.21.1.2 (N:) Cytochrome b6 subunit of the cytochrome b6f complex {Mastigocladus laminosus}
eiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykptvteayasvqyi
mnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwisgvilavitvsfg
vtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatltryysahtfvlp
wliavfmllhflmirkqgisgp

SCOP Domain Coordinates for d1vf5n_:

Click to download the PDB-style file with coordinates for d1vf5n_.
(The format of our PDB-style files is described here.)

Timeline for d1vf5n_: