SCOP 1.71: Domain d1vf5f_: 1vf5 F:

Lineage for d1vf5f_ (1vf5 F:)

1. Root: SCOP 1.71

2. Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.25: PetM subunit of the cytochrome b6f complex [103441] (1 family)

5. Family f.23.25.1: PetM subunit of the cytochrome b6f complex [103442] (1 protein)

6. Protein PetM subunit of the cytochrome b6f complex [103443] (2 species)

7. Species Mastigocladus laminosus [TaxId:83541] [103444] (1 PDB entry)

8. Domain d1vf5f_: 1vf5 F: [100586]
   Other proteins in same PDB: d1vf5a_, d1vf5b_, d1vf5c1, d1vf5c2, d1vf5c3, d1vf5d1, d1vf5d2, d1vf5e_, d1vf5g_, d1vf5h_, d1vf5n_, d1vf5o_, d1vf5p1, d1vf5p2, d1vf5p3, d1vf5q1, d1vf5q2, d1vf5r_, d1vf5t_, d1vf5u_

Details for d1vf5f_

PDB Entry: 1vf5, 3 Å

PDB Description: Crystal Structure of Cytochrome b6f Complex from M.laminosus

SCOP Domain Sequences for d1vf5f_:

Sequence; same for both SEQRES and ATOM records:

>d1vf5f_ f.23.25.1 (F:) PetM subunit of the cytochrome b6f complex {Mastigocladus laminosus}
mteemlyaallsfglifvgwglgvlllkiqgae

Timeline for d1vf5f_:

• d1vf5f_ first appeared in SCOP 1.67
  
• d1vf5f_ appears in SCOP 1.69
  
• d1vf5f_ appears in SCOP 1.73
  
• d1vf5f_ appears in the current release, SCOPe 2.08